Protein coding transcript 2338

• Transcript: Ll_transcript_329234
• CDS coordinates: 174-716 (+)
• Peptide sequence: MLLDNCRAFAEYLWNNFLGGTSNTRPLGNAILNGIDFAIVTGSTQYWDELAKAISGYNGKGNKIYLCAAPQCPTPDKWLNSAIETGLFDYVWVQFYNNPPCQYNGNAENLKSYWNKWIVSKGGKIFLGLPAAKDASGYIPPEVLKAQVLPFIKNSPKYGGVMIWSKFSDQGYSSVIKTQV*
• ORF Type: complete

Annotations of Ll_transcript_329234

• Blastp: Acidic endochitinase from Nicotiana with 66.67% of identity
• Blastx: Acidic endochitinase from Nicotiana with 66.67% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (107825584)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462145.1)
• Pfam: Glycosyl hydrolases family 18 (PF00704.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;