Transcript | Ll_transcript_130757 |
---|---|
CDS coordinates | 2528-2845 (+) |
Peptide sequence | MEAGKQKDNDRRDDVQSGLNRITMPLVTRSILEVVIPEYAVPKLIARSKSKLAQISELSGANVTLVEDRPDVTQKIIQLSGTPEQAERAQSLLQGFILSTQEDGP* |
ORF Type | complete |
Blastp | RNA-binding KH domain-containing protein RCF3 from Arabidopsis with 65.69% of identity |
---|---|
Blastx | RNA-binding KH domain-containing protein RCF3 from Arabidopsis with 54% of identity |
Eggnog | mRNA transport(ENOG410XNN8) |
Kegg | Link to kegg annotations (AT5G53060) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019437353.1) |
Pfam | KH domain (PF00013.28) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer