Protein coding transcript 233861

• Transcript: Ll_transcript_132208
• CDS coordinates: 663-1847 (+)
• Peptide sequence: MLKGVEDLADAVKVTMGPKGRNVVIEQSWGAPKVTKDGVTVAKSIEFNDKIKNIGASLVKQVANATNDVAGDGTTCATVLTRAIFTEGCKSVAAGMNAMDLRRGITLAVDAVVTNLKSRARMISTSEEIAQVGTISANGEREIGELIAKAMEKVGKEGVITIQDGKTLYNELEVVEGMKLDRGYISPYFITNQKNQKCELDDPLILIHEKKISSIQSVVKVLELALKKQRPLLIVAEDVESDALATLILNKLRAGVKVCAIKAPGFGENRKSGLQDLAVLTGGSVITEELGLNLEKVDLDLLGTCKKVTISKDDTVILDGAADKKALEERCEQIRSAIDNSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEG
• ORF Type: 3prime_partial

Annotations of Ll_transcript_132208

• Blastp: Chaperonin CPN60-2, mitochondrial from Cucurbita with 93.16% of identity
• Blastx: Chaperonin CPN60-2, mitochondrial from Cucurbita with 91.16% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0001044)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413888.1)
• Pfam: TCP-1/cpn60 chaperonin family (PF00118.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;