Protein coding transcript 233872

• Transcript: Ll_transcript_132195
• CDS coordinates: 206-505 (+)
• Peptide sequence: MLKGVEDLADAVKVTMGPKGRNVVIEQSWGAPKVTKDGVTVAKSIEFNDKIKNIGASLVKQVANATNDVAGDGTTCATVLTRAIFTEGCKSVAAGMNAMD
• ORF Type: 3prime_partial

Annotations of Ll_transcript_132195

• Blastp: Chaperonin CPN60, mitochondrial from Arabidopsis with 97% of identity
• Blastx: Chaperonin CPN60, mitochondrial from Arabidopsis with 95.93% of identity
• Eggnog: Prevents misfolding and promotes the refolding and proper assembly of unfolded polypeptides generated under stress conditions (By similarity)(COG0459)
• Kegg: Link to kegg annotations (AT3G23990)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413888.1)
• Pfam: TCP-1/cpn60 chaperonin family (PF00118.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;