Protein coding transcript 233903

• Transcript: Ll_transcript_132961
• CDS coordinates: 129-926 (+)
• Peptide sequence: MSKIILSSPSPTLFPLTLFFILLLLLHPCEAEDVAIYWGQNVKEGNLTETCATAKYSFINIAFLTTFGSSKTPQLNLAGHCDPSTNGCTLIGRDIMNCQNQGIKVMLSIGGGSEGSYALTSSEDAKNVSDYLWNNFLGGTNYTSSRPFGDAILDGIDFDIYGTNSHWDELARYLKSHNNNTTTKTIYLTAAPQCTFPDYSMGTALDTGLFDYVWIQFYNNPPCDYGKESIDNIVNAWNKWTTSLKGAKVFLGLPADPAAAATAKH*
• ORF Type: complete

Annotations of Ll_transcript_132961

• Blastp: Acidic endochitinase from Vitis with 58.66% of identity
• Blastx: G-type lectin S-receptor-like serine/threonine-protein kinase CES101 from Arabidopsis with 59.84% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (100233088)
• CantataDB: Link to cantataDB annotations (CNT0001079)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458282.1)
• Pfam: Glycosyl hydrolases family 18 (PF00704.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;