Protein coding transcript 233956

• Transcript: Ll_transcript_133154
• CDS coordinates: 201-1178 (+)
• Peptide sequence: MATACVTDLTRATACRDTVAASHFKFISIFIIFFTSMTGMSLPVLLARIFQGKSLYDRAITVIKCFAAGVILSTSLVHVLPNAHAALADCHVGSRHPWRDFPFAGLVTLVGVILALSVDLIATSHMSHAPYAPVVTQEKESAVELGCDGSGGEREKVEEELVKLKQRLVSQVLEIGIIFHSVIIGVTMGMSQNVCTIRPLVTALAFHQIFEGMGLGGCVAQAGFSFATMAYMCFMFSVTTPLGIMLGMALFSLTGYDDSNPNTLIMEGLLGSISSGILIYMALVDLIAVDFFHNKLMNTNPGLKKASFVALILGSASMSILALWA*
• ORF Type: complete

Annotations of Ll_transcript_133154

• Blastp: Zinc transporter 6, chloroplastic from Arabidopsis with 66.08% of identity
• Blastx: Zinc transporter 6, chloroplastic from Arabidopsis with 65.78% of identity
• Eggnog: zinc transporter(ENOG4111GP2)
• Kegg: Link to kegg annotations (AT2G30080)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431986.1)
• Pfam: ZIP Zinc transporter (PF02535.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;