Protein coding transcript 233985

• Transcript: Ll_transcript_130591
• CDS coordinates: 228-908 (+)
• Peptide sequence: MGTLQSWRKAYGALKDTTKVGLAHVNSDYADLDVAIVKATNHVECPPKERHLRKIQFAVGAVQPRADVAYCIHSLARRLAKTRNWTVALKTLIVIHRLLREGDPTFREELLNFSKRGRILQLSNFKDDSSPIAWDCSAWVRTYAFFLEERLECFRILKYDIEAERLPKSAPGQEKGHSRTRGLDSEELLEQLPALQKLLYRLLGCRPEGAAFSNHVIQYALALVCI*
• ORF Type: complete

Annotations of Ll_transcript_130591

• Blastp: Putative clathrin assembly protein At2g01600 from Arabidopsis with 87.05% of identity
• Blastx: Putative clathrin assembly protein At2g01600 from Arabidopsis with 87.05% of identity
• Eggnog: Clathrin assembly protein(ENOG410XQ90)
• Kegg: Link to kegg annotations (AT2G01600)
• CantataDB: Link to cantataDB annotations (CNT0000240)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462199.1)
• Pfam: ANTH domain (PF07651.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;