Protein coding transcript 2340

• Transcript: Ll_transcript_329236
• CDS coordinates: 3-410 (+)
• Peptide sequence: SSIYTMAHKIPTPLTLMFLLFTAMFNASHAGVISIYWGQNGDEGSLADACNTGNYAIVNIAFLSSFGNGNNPKLNLGSHCDASNNGCSFLSNQITTCQKLGIKVMLSIGGREGNHDLSSSADARKVFYLICLLMR*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_329236

• Blastp: Acidic endochitinase from Vigna with 59.09% of identity
• Blastx: Acidic endochitinase from Vigna with 61% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (108339599)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462145.1)
• Pfam: Glycosyl hydrolases family 18 (PF00704.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;