Protein coding transcript 234001

• Transcript: Ll_transcript_132686
• CDS coordinates: 545-1213 (+)
• Peptide sequence: MVPLLYYFVLFSNPKVFFFSSNSYKTNILLIFHIIVLVVGDLLFAFLKFIVLIGNIQAHPELNKSERKRLCRILDCKKLSMEACMHAAQNELLPLRVVVQVLFFEQARAAAAGGKVTDFPSNIKELLTTHGIDPSKYTAPLSTTTSIHAEDNWSVSGFKSPKSRSSTLKMKLAEEDDLDENDSLRNGIGRNSRFKSICAIPTQPKKMLSKLWSTNRSVNEKN*
• ORF Type: complete

Annotations of Ll_transcript_132686

• Blastp: BTB/POZ domain-containing protein At1g67900 from Arabidopsis with 65.52% of identity
• Blastx: BTB/POZ domain-containing protein At1g67900 from Arabidopsis with 65.52% of identity
• Eggnog: BTB POZ domain-containing protein(ENOG410YBGR)
• Kegg: Link to kegg annotations (AT1G67900)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424116.1)
• Pfam: NPH3 family (PF03000.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;