Transcript | Ll_transcript_132356 |
---|---|
CDS coordinates | 400-699 (+) |
Peptide sequence | MINEVDADGNGTIEFVEFLNLMAKKFKETDVEEDLKEAFKVFDKDQDGYISATELRHVMINLGEKLSDEEVKQMIKEADLDGDGQVNYDEFAKLMMSIG* |
ORF Type | complete |
Blastp | Calmodulin-like protein 8 from Arabidopsis with 79.59% of identity |
---|---|
Blastx | Calmodulin-like protein 8 from Arabidopsis with 78.23% of identity |
Eggnog | Calcium-binding protein(COG5126) |
Kegg | Link to kegg annotations (AT4G14640) |
CantataDB | Link to cantataDB annotations (CNT0001037) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_017413890.1) |
Pfam | EF hand (PF00036.31) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer