Protein coding transcript 234152

• Transcript: Ll_transcript_132368
• CDS coordinates: 1-336 (+)
• Peptide sequence: QLYTQHISLPFSYLFFSLSLYIMVDVLSEEQILEIKEAFGFFDKDGDGCITVEDLAIVIRSLDQNPSEEEVQNMINEVDADGNGTIEFVEFLNLMAKKFKVSYSTSLIHYC*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_132368

• Blastp: Calmodulin-2 from Oryza sativa with 69.51% of identity
• Blastx: Calmodulin-2 from Oryza sativa with 69.51% of identity
• Eggnog: Calcium-binding protein(COG5126)
• Kegg: Link to kegg annotations (4339172)
• CantataDB: Link to cantataDB annotations (CNT0001037)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450475.1)
• Pfam: EF hand (PF00036.31)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;