Protein coding transcript 234153

• Transcript: Ll_transcript_132371
• CDS coordinates: 67-519 (+)
• Peptide sequence: MVDVLSEEQILEIKEAFGFFDKDGDGCITVEDLAIVIRSLDQNPSEEEVQNMINEVDADGNGTIEFVEFLNLMAKKFKETDVEEDLKEAFKVFDKDQDGYISATELRHVMINLGEKLSDEEVKQMIKEADLDGDGQVNYDEFAKLMMSIG*
• ORF Type: complete

Annotations of Ll_transcript_132371

• Blastp: Calmodulin-like protein 11 from Arabidopsis with 76.71% of identity
• Blastx: Calmodulin-like protein 11 from Arabidopsis with 76.71% of identity
• Eggnog: Calcium-binding protein(COG5126)
• Kegg: Link to kegg annotations (AT3G22930)
• CantataDB: Link to cantataDB annotations (CNT0001037)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014512636.1)
• Pfam: EF hand (PF00036.31)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;