Transcript | Ll_transcript_366669 |
---|---|
CDS coordinates | 255-806 (+) |
Peptide sequence | MEEDSVNGNSIISKTTQELGIEGQKYLEETTEYAFQILSSMNDELCNPVLWFTSPSPSNTTSPNPNAPSSIGDANSDNSNHHAKSGGGGGAGGALEESLFRYKNAVASLKTTLAAIPNSHKAKAFGSGSDASPADEAEIEKLAERASSLKKEVANKNLHLKILIDQLRDLITDISTWQSPCST* |
ORF Type | complete |
Blastp | Mediator of RNA polymerase II transcription subunit 30 from Arabidopsis with 56.18% of identity |
---|---|
Blastx | Mediator of RNA polymerase II transcription subunit 30 from Arabidopsis with 55.06% of identity |
Eggnog | NA(ENOG411292K) |
Kegg | Link to kegg annotations (AT5G63480) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019419114.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer