Protein coding transcript 23417

• Transcript: Ll_transcript_366669
• CDS coordinates: 255-806 (+)
• Peptide sequence: MEEDSVNGNSIISKTTQELGIEGQKYLEETTEYAFQILSSMNDELCNPVLWFTSPSPSNTTSPNPNAPSSIGDANSDNSNHHAKSGGGGGAGGALEESLFRYKNAVASLKTTLAAIPNSHKAKAFGSGSDASPADEAEIEKLAERASSLKKEVANKNLHLKILIDQLRDLITDISTWQSPCST*
• ORF Type: complete

Annotations of Ll_transcript_366669

• Blastp: Mediator of RNA polymerase II transcription subunit 30 from Arabidopsis with 56.18% of identity
• Blastx: Mediator of RNA polymerase II transcription subunit 30 from Arabidopsis with 55.06% of identity
• Eggnog: NA(ENOG411292K)
• Kegg: Link to kegg annotations (AT5G63480)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419114.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;