Protein coding transcript 234188

• Transcript: Ll_transcript_131489
• CDS coordinates: 426-1115 (+)
• Peptide sequence: MPENREPLRNAASNHSGDNIQEAIGRLKINGNRDIDAAAQSTPLPERPGEADCLYYLRTGMCGYGGNCRYNHPANVSLGPHYGEELPERIGEPDCEYFLKTGTCKYGSTCKYHHPKDRKGAAPISFNSLGLPMRQEEKSCPYYMRTGSCKFGLACKFHHPHIGVSSVAGSPTSAILPASGLPYVGGFSGWQLPRMSYLSGQGIQCYVPPFLSSPQGIIPTQNWNTYMVS*
• ORF Type: complete

Annotations of Ll_transcript_131489

• Blastp: Zinc finger CCCH domain-containing protein 3 from Arabidopsis with 48.94% of identity
• Blastx: Zinc finger CCCH domain-containing protein 3 from Arabidopsis with 48.94% of identity
• Eggnog: zinc finger(COG5063)
• Kegg: Link to kegg annotations (AT1G04990)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433974.1)
• Pfam: Zinc finger C-x8-C-x5-C-x3-H type (and similar) (PF00642.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;