Transcript | Ll_transcript_366651 |
---|---|
CDS coordinates | 903-1286 (+) |
Peptide sequence | MNFVPLFSQVAERALFLWNNDHIVNLIRQNCKVVLPIIFPALEKNTRSHWNQAVHSLTLNVRKIFNDLDPDLFKECLLKFEENESKKDEINEGREATWKRLEELAAKRAANSEAVLIGRELTHNSAG* |
ORF Type | complete |
Blastp | Serine/threonine protein phosphatase 2A 59 kDa regulatory subunit B' eta isoform from Arabidopsis with 74.29% of identity |
---|---|
Blastx | Serine/threonine protein phosphatase 2A 59 kDa regulatory subunit B' eta isoform from Arabidopsis with 74.29% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (AT3G26020) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019438323.1) |
Pfam | Protein phosphatase 2A regulatory B subunit (B56 family) (PF01603.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer