Transcript | Ll_transcript_131633 |
---|---|
CDS coordinates | 942-1415 (+) |
Peptide sequence | MFKYYSVHGQWKNHELKVKDSKTLLFGEKSVAVYGYRNPEEIPWAESGAEIIVESTGVFTDKEKAAAHLKGGAKKVIISAPSKDAPMFVVGVNEHEYKPELDIISNASCTTNCLAPLAKVINDRFGIVEGLMTTVHSITATQKTVDGPSSKDWRGGRA |
ORF Type | 3prime_partial |
Blastp | Glyceraldehyde-3-phosphate dehydrogenase, cytosolic from Nicotiana with 89.24% of identity |
---|---|
Blastx | Glyceraldehyde-3-phosphate dehydrogenase, cytosolic from Magnolia with 90% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019434986.1) |
Pfam | Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain (PF00044.23) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer