Transcript | Ll_transcript_131104 |
---|---|
CDS coordinates | 496-996 (+) |
Peptide sequence | MPPSVVDPFLLPPSLPPLSSDSVSRRSEDQRFSDLRGLKWRMNLGVLPSSSSIHDLRRATADSRRRYASLRRQLLVESHIAKDGSSSDDVVMDNPLSQNPDSPWSRFFHSVELERIVVQDLSRLYPEHGCYFQTPGCQGILRRILLLWCLRHSECGYRQGVLITSS* |
ORF Type | complete |
Blastp | TBC1 domain family member 5 homolog B from Dictyostelium with 29.77% of identity |
---|---|
Blastx | TBC1 domain family member 5 homolog B from Dictyostelium with 29.77% of identity |
Eggnog | TBC1 domain family, member 5(ENOG410YX8Z) |
Kegg | Link to kegg annotations (DDB_G0281891) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019417917.1) |
Pfam | Rab-GTPase-TBC domain (PF00566.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer