Transcript | Ll_transcript_329291 |
---|---|
CDS coordinates | 268-843 (+) |
Peptide sequence | MSPEKVSVTIATFQNFLTRLHRHAKRRPWTELADRSSISVPQSLAEAYSRVRKNTIYFRVNYLIVVAVVLAVSLLRRPFTLLLLGSVAGAWLYLYVLRQPEQQLVIFGRVFTDCEALVGLSFATVAVALWTNVVSVIISAVTVGVAVVCCHGALRVPEDRFLEQQEQRSWASGLFPDSRPVSSVHIGPLAV* |
ORF Type | complete |
Blastp | - |
---|---|
Blastx | PRA1 family protein B2 from Arabidopsis with 53.52% of identity |
Eggnog | Prenylated RAB acceptor(COG5130) |
Kegg | Link to kegg annotations (AT2G40380) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019457724.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer