Protein coding transcript 2343

• Transcript: Ll_transcript_329291
• CDS coordinates: 268-843 (+)
• Peptide sequence: MSPEKVSVTIATFQNFLTRLHRHAKRRPWTELADRSSISVPQSLAEAYSRVRKNTIYFRVNYLIVVAVVLAVSLLRRPFTLLLLGSVAGAWLYLYVLRQPEQQLVIFGRVFTDCEALVGLSFATVAVALWTNVVSVIISAVTVGVAVVCCHGALRVPEDRFLEQQEQRSWASGLFPDSRPVSSVHIGPLAV*
• ORF Type: complete

Annotations of Ll_transcript_329291

• Blastp: -
• Blastx: PRA1 family protein B2 from Arabidopsis with 53.52% of identity
• Eggnog: Prenylated RAB acceptor(COG5130)
• Kegg: Link to kegg annotations (AT2G40380)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019457724.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;