Transcript | Ll_transcript_329224 |
---|---|
CDS coordinates | 128-475 (+) |
Peptide sequence | MPTLNLFTNVPVDSVIASDILRDATKAVAKIIGKPESYVMILLNGGVPIAFSGTEEPAAYGELISIGGLSPSVNGKLSSTIAEILQTKLYIDSSRFYIKFYDVQRSFFGFNGSTF* |
ORF Type | complete |
Blastp | Macrophage migration inhibitory factor homolog from Brugia with 44.35% of identity |
---|---|
Blastx | Macrophage migration inhibitory factor homolog from Brugia with 44.35% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (Bm1_28435) |
CantataDB | Link to cantataDB annotations (CNT0000486) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019462611.1) |
Pfam | Macrophage migration inhibitory factor (MIF) (PF01187.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer