Protein coding transcript 2344

• Transcript: Ll_transcript_329224
• CDS coordinates: 128-475 (+)
• Peptide sequence: MPTLNLFTNVPVDSVIASDILRDATKAVAKIIGKPESYVMILLNGGVPIAFSGTEEPAAYGELISIGGLSPSVNGKLSSTIAEILQTKLYIDSSRFYIKFYDVQRSFFGFNGSTF*
• ORF Type: complete

Annotations of Ll_transcript_329224

• Blastp: Macrophage migration inhibitory factor homolog from Brugia with 44.35% of identity
• Blastx: Macrophage migration inhibitory factor homolog from Brugia with 44.35% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (Bm1_28435)
• CantataDB: Link to cantataDB annotations (CNT0000486)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462611.1)
• Pfam: Macrophage migration inhibitory factor (MIF) (PF01187.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;