Transcript | Ll_transcript_131118 |
---|---|
CDS coordinates | 314-679 (+) |
Peptide sequence | MHERKAAMAQEADAFVALPGGYGTMEELLEIITWAQLGIHKKPVGLLNVDGYYNCLLALFDNGVKEGFIKPGARDIVISAPSAKELMMKMEQYSPTHEHVAPHESWQMKQLGNYPGQENAE* |
ORF Type | complete |
Blastp | Cytokinin riboside 5'-monophosphate phosphoribohydrolase LOG8 from Arabidopsis with 81.51% of identity |
---|---|
Blastx | Cytokinin riboside 5'-monophosphate phosphoribohydrolase LOG8 from Arabidopsis with 79.85% of identity |
Eggnog | decarboxylase(COG1611) |
Kegg | Link to kegg annotations (AT5G11950) |
CantataDB | Link to cantataDB annotations (CNT0000834) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019417183.1) |
Pfam | Possible lysine decarboxylase (PF03641.13) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer