Protein coding transcript 234405

• Transcript: Ll_transcript_131118
• CDS coordinates: 314-679 (+)
• Peptide sequence: MHERKAAMAQEADAFVALPGGYGTMEELLEIITWAQLGIHKKPVGLLNVDGYYNCLLALFDNGVKEGFIKPGARDIVISAPSAKELMMKMEQYSPTHEHVAPHESWQMKQLGNYPGQENAE*
• ORF Type: complete

Annotations of Ll_transcript_131118

• Blastp: Cytokinin riboside 5'-monophosphate phosphoribohydrolase LOG8 from Arabidopsis with 81.51% of identity
• Blastx: Cytokinin riboside 5'-monophosphate phosphoribohydrolase LOG8 from Arabidopsis with 79.85% of identity
• Eggnog: decarboxylase(COG1611)
• Kegg: Link to kegg annotations (AT5G11950)
• CantataDB: Link to cantataDB annotations (CNT0000834)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417183.1)
• Pfam: Possible lysine decarboxylase (PF03641.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;