Protein coding transcript 234449

• Transcript: Ll_transcript_132013
• CDS coordinates: 1654-2265 (+)
• Peptide sequence: MTAAQALGHPWIKNYNDVRVPLDILMLKLMKAYMHSSSLRKSALKALSKTLAVDELSYLKEQFALLEPNKSGTITFENVKAALMKNATDAMKESRIPDFLASLNALEYRTMDFDEYCAAAFSVHQLEALDRWEQHARCAYELFEKDGNRAIVIEELISELGLDPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHGPSRNLVKPQ*
• ORF Type: complete

Annotations of Ll_transcript_132013

• Blastp: CDPK-related kinase 5 from Arabidopsis with 77.11% of identity
• Blastx: CDPK-related kinase 5 from Arabidopsis with 77.43% of identity
• Eggnog: calcium-dependent protein kinase(ENOG410XRMJ)
• Kegg: Link to kegg annotations (AT3G50530)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_016184877.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;