Transcript | Ll_transcript_132038 |
---|---|
CDS coordinates | 2132-2656 (+) |
Peptide sequence | MKAYMHSSSLRKTALRALSKTLTVDELFYMKEQFALLEPNENGTVSLENIKAALMKNATNAMKETRIPDLLASLNALQHKRMDFDEFCAAALSVHQLEALDRWEQHARCAYELFEKDGNRAIVIEELASELCLGPSVPVHSVLHDWIRHTDGKLSFLGFVKLLHGPSRSLSKAQ* |
ORF Type | complete |
Blastp | CDPK-related protein kinase from Daucus sect. Daucus with 81.71% of identity |
---|---|
Blastx | CDPK-related kinase 2 from Arabidopsis with 68.53% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019422354.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer