Protein coding transcript 234455

• Transcript: Ll_transcript_132046
• CDS coordinates: 1741-2352 (+)
• Peptide sequence: MTAAQALGHPWIKNYNDVRVPLDILMLKLMKAYMHSSSLRKSALKALSKTLAVDELSYLKEQFALLEPNKSGTITFENVKAALMKNATDAMKESRIPDFLASLNALEYRTMDFDEYCAAAFSVHQLEALDRWEQHARCAYELFEKDGNRAIVIEELISELGLDPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHGPSRNLVKPQ*
• ORF Type: complete

Annotations of Ll_transcript_132046

• Blastp: CDPK-related kinase 5 from Arabidopsis with 77.11% of identity
• Blastx: CDPK-related kinase 5 from Arabidopsis with 70.98% of identity
• Eggnog: calcium-dependent protein kinase(ENOG410XRMJ)
• Kegg: Link to kegg annotations (AT3G50530)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_017410332.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;