Transcript | Ll_transcript_131367 |
---|---|
CDS coordinates | 349-1164 (+) |
Peptide sequence | MITLTDFYHVMTAMVPLYVAMILAYGSVKWWKIFSPDQCSGINRFVALFAVPLLSFHFIASNNPYKMNLRFLAADTLQKIIVLFVLAIWSNVTKRGCLEWTITLFSLSTLPNTLVMGIPLLKGMYGEFSGSLMVQIVVLQCIIWYTLMLFMFEFRAARILISEQFPDTAGSIVSIHVDSDVMSLDGRQVPLETETEIKEDGKLHVTVRKSNASRSDIFSRRSQGLSSTTPRPSNLTNAEIYSLQSSRNPTPRGSSFNHTDFYSMMASGGGGS |
ORF Type | 3prime_partial |
Blastp | Auxin efflux carrier component 1 from Arabidopsis with 87.78% of identity |
---|---|
Blastx | Auxin efflux carrier component 1 from Arabidopsis with 87.78% of identity |
Eggnog | auxin efflux carrier(ENOG410Y9XE) |
Kegg | Link to kegg annotations (AT1G73590) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019430461.1) |
Pfam | Membrane transport protein (PF03547.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer