Protein coding transcript 234469

• Transcript: Ll_transcript_131367
• CDS coordinates: 349-1164 (+)
• Peptide sequence: MITLTDFYHVMTAMVPLYVAMILAYGSVKWWKIFSPDQCSGINRFVALFAVPLLSFHFIASNNPYKMNLRFLAADTLQKIIVLFVLAIWSNVTKRGCLEWTITLFSLSTLPNTLVMGIPLLKGMYGEFSGSLMVQIVVLQCIIWYTLMLFMFEFRAARILISEQFPDTAGSIVSIHVDSDVMSLDGRQVPLETETEIKEDGKLHVTVRKSNASRSDIFSRRSQGLSSTTPRPSNLTNAEIYSLQSSRNPTPRGSSFNHTDFYSMMASGGGGS
• ORF Type: 3prime_partial

Annotations of Ll_transcript_131367

• Blastp: Auxin efflux carrier component 1 from Arabidopsis with 87.78% of identity
• Blastx: Auxin efflux carrier component 1 from Arabidopsis with 87.78% of identity
• Eggnog: auxin efflux carrier(ENOG410Y9XE)
• Kegg: Link to kegg annotations (AT1G73590)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430461.1)
• Pfam: Membrane transport protein (PF03547.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;