Transcript | Ll_transcript_132767 |
---|---|
CDS coordinates | 2-436 (+) |
Peptide sequence | KDIGSFIHYYVAKNKASRSSFCVSLKLMIMASSWFGTTITILPFQFYNKLNRNPTLVTFSCTNKHKDKDHVPLSVSSAYDVLGVNPHSSPFDIKAAFRSKVKQFHPDVNRNEGNSDAMIRSVIQAYQHNTWCWCRYYPTTPKQR* |
ORF Type | 5prime_partial |
Blastp | Uncharacterized 19.0 kDa protein in cobS 5'region from Pseudomonas with 42.31% of identity |
---|---|
Blastx | Uncharacterized 19.0 kDa protein in cobS 5'region from Pseudomonas with 42.31% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019419813.1) |
Pfam | DnaJ domain (PF00226.30) |
Rfam | - |
GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer