| Transcript | Ll_transcript_132775 |
|---|---|
| CDS coordinates | 2-436 (+) |
| Peptide sequence | KDIGSFIHYYVAKNKASRSSFCVSLKLMIMASSWFGTTITILPFQFYNKLNRNPTLVTFSCTNKHKDKDHVPLSVSSAYDVLGVNPHSSPFDIKAAFRSKVKQFHPDVNRNEGNSDAMIRSVIQAYQHNTWCWCRYYPTTPKQR* |
| ORF Type | 5prime_partial |
| Blastp | Uncharacterized 19.0 kDa protein in cobS 5'region from Pseudomonas with 42.31% of identity |
|---|---|
| Blastx | Chaperone protein dnaJ C76, chloroplastic from Arabidopsis with 32.1% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019419813.1) |
| Pfam | DnaJ domain (PF00226.30) |
| Rfam | - |
| GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer