Protein coding transcript 234576

• Transcript: Ll_transcript_130559
• CDS coordinates: 911-1750 (+)
• Peptide sequence: MIGRKKGIEGNLVSPTRLRPLIGVDIRYVVSGCASCHCVALDVEGRCYTWGRNDKGQLGHGDTIQRDRPTVVSGLSKYKILKAGSGRSHTVVVTDDGNSLAFGWNKHEQLGVGSVRNEIESSPVRCLVSEVTYTTCGGDFTVWLSSVEGSSILTAGLPQYGQLGHGTDNEYNSKDGSVKLVYEAQPRPRAIASLAAETIVKVACGTNHTVAVDKNGCVYTWGFGGYGRLGHREQKDEWAPRRVDVFQNRNVLPPDAIISAGSVNSACTAGIPHIWSFVQ*
• ORF Type: complete

Annotations of Ll_transcript_130559

• Blastp: Protein RCC2 from Homo with 37.92% of identity
• Blastx: Protein RCC2 from Homo with 38.05% of identity
• Eggnog: regulator of chromosome condensation(COG5184)
• Kegg: Link to kegg annotations (55920)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415445.1)
• Pfam: Regulator of chromosome condensation (RCC1) repeat (PF00415.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;