Transcript | Ll_transcript_131568 |
---|---|
CDS coordinates | 1974-2681 (+) |
Peptide sequence | MNDTLYDQHEQAKAEAENATRNAYQETFRRGKAGKYVMDTIHMAKASESLYLEELDLRTSAEEELAKEIEELDNMKSQRDKVKEELQLALDQKSSLESQISSSELTIKELEQKIISAVDLLQSYKNDRDELQMQRDSALREAEELRGKQGETLRMHVSQLFSEFSFSEIEEATSNFKPSLKIGEGGYGSIFKGILHHTEVAIKLLHPNSMQGPSEFQQEVDVLSKIRHPNLITLIG |
ORF Type | 3prime_partial |
Blastp | U-box domain-containing protein 33 from Arabidopsis with 53.81% of identity |
---|---|
Blastx | U-box domain-containing protein 33 from Arabidopsis with 53.97% of identity |
Eggnog | Serine Threonine protein kinase(COG0515) |
Kegg | Link to kegg annotations (AT2G45910) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019461761.1) |
Pfam | Protein kinase domain (PF00069.24) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer