Protein coding transcript 234603

• Transcript: Ll_transcript_131572
• CDS coordinates: 785-1492 (+)
• Peptide sequence: MNDTLYDQHEQAKAEAENATRNAYQETFRRGKAGKYVMDTIHMAKASESLYLEELDLRTSAEEELAKEIEELDNMKSQRDKVKEELQLALDQKSSLESQISSSELTIKELEQKIISAVDLLQSYKNDRDELQMQRDSALREAEELRGKQGETLRMHVSQLFSEFSFSEIEEATSNFKPSLKIGEGGYGSIFKGILHHTEVAIKLLHPNSMQGPSEFQQEVDVLSKIRHPNLITLIG
• ORF Type: 3prime_partial

Annotations of Ll_transcript_131572

• Blastp: U-box domain-containing protein 33 from Arabidopsis with 53.81% of identity
• Blastx: U-box domain-containing protein 33 from Arabidopsis with 53.97% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT2G45910)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461761.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;