| Transcript | Ll_transcript_133042 |
|---|---|
| CDS coordinates | 3-308 (+) |
| Peptide sequence | KRCHLDCKCQNHCRRGSFFWNLNQEVGDMVYPTFEFILFCTKIFIYDYRMMMLDEEQISFRSASHMFDGIEDYSHQIAEMMGLRNESYFIQAGVSTFCDTD* |
| ORF Type | 5prime_partial |
| Blastp | Probable pectin methyltransferase QUA2 from Arabidopsis with 62.75% of identity |
|---|---|
| Blastx | Probable pectin methyltransferase QUA2 from Arabidopsis with 84.62% of identity |
| Eggnog | pectin methyltransferase(ENOG410Y9W6) |
| Kegg | Link to kegg annotations (AT1G78240) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019456261.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer