Transcript | Ll_transcript_133063 |
---|---|
CDS coordinates | 458-1609 (+) |
Peptide sequence | MSRPLQRGVTGVRTPDSKSKDKSEKEDWDNRRASSDHSPLSPFRLLFGDNNSHSKYGINENGFASDPFIVGNPRSRLKLMLLFLKFSLVFIVVLALTGSFWWTMSISASSRGHIYHGYRRLQEKLVSDLVDISEFSRGTAKFKELESCSVEHENFVPCFNVSENLALGNSDGNEFDRQCGRELRQNCLVLPPVSYKIPLRWPTGRDVIWIANVKITAEEVLSSGTLTKRMMMLDEEQISFRSASHMFDGIEDYSHQIAEMMGLRNESYFIQAGVQTILDIGCGYGSFGAHLFHSQLLTMCIANYEPSGSQVQLTLERGLPAMIASFTSKQLPYPSLSFDMLHCAWCGIDWDQKGIFSILICYFLLGLHTSILFCTFSTTIFYL* |
ORF Type | complete |
Blastp | Probable pectin methyltransferase QUA2 from Arabidopsis with 66.12% of identity |
---|---|
Blastx | Probable pectin methyltransferase QUA2 from Arabidopsis with 66.39% of identity |
Eggnog | pectin methyltransferase(ENOG410Y9W6) |
Kegg | Link to kegg annotations (AT1G78240) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019456261.1) |
Pfam | Putative S-adenosyl-L-methionine-dependent methyltransferase (PF03141.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer