Protein coding transcript 234681

• Transcript: Ll_transcript_133035
• CDS coordinates: 3126-3971 (+)
• Peptide sequence: MLSQQDATVVWKKTSKKSCYSSRKSSSAPPLCGKGHDVETPYYRDLQNCIGGTQSSRWIPIEKKERWPSRANLNKNELAVYGLQPDEFAEDSESWRIAVRNYWSLLSPLIFSDHPKRPGEEDPPPPYNMFRNVLDMNAHFGGFNSALLQARKSVWVMNVVPVSGLNYLPLIHDRGFVGVLHDWCEAFPTYPRTYDLVHAAGLLSLETSQHRRCTVLDLFNEIDRLLRPEGWIIFHDTVPIIESARAQTARLNWDARVIEIESDSDKRLLICQKPFFKKQAK*
• ORF Type: complete

Annotations of Ll_transcript_133035

• Blastp: Probable pectin methyltransferase QUA2 from Arabidopsis with 70.11% of identity
• Blastx: Probable pectin methyltransferase QUA2 from Arabidopsis with 70.3% of identity
• Eggnog: pectin methyltransferase(ENOG410Y9W6)
• Kegg: Link to kegg annotations (AT1G78240)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460930.1)
• Pfam: Putative S-adenosyl-L-methionine-dependent methyltransferase (PF03141.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;