Protein coding transcript 234796

• Transcript: Ll_transcript_130492
• CDS coordinates: 1-999 (+)
• Peptide sequence: QGANLYLKNLDDNVTDDKLKELFSEFGTITSSKVMVDTLGHSKGTGFVSFSTPEEANKALHEMNGKMIGRKPLYVAVAQRKEERKARLQAQFSQIRAPGAVAPLPAGIPGYHPGAPRFAPQQLYYGQGTPGLIPPQPAGYGFQQPLMPGIRPGVSPNYIMPYQLQRQGQPAQRMGVRRAGNIQQVQQNQMLHRNSYMANGQNGVDPSVAPHGLAGPVTPLPFDGSGVIADPNGLHPGTLSNSLASALASATPENQRTMLGEQLYPLVGRLTPSNQTAKVTGMLLEMDKSEVIHLIESPEELKMKVSEAMQVLREAGPGSDVGDQLGSLSLNE*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_130492

• Blastp: Polyadenylate-binding protein 5 from Arabidopsis with 51.88% of identity
• Blastx: Polyadenylate-binding protein 5 from Arabidopsis with 51.45% of identity
• Eggnog: poly(A) binding protein, cytoplasmic(ENOG410XR5X)
• Kegg: Link to kegg annotations (AT1G71770)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_015942532.1)
• Pfam: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF00076.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;