Protein coding transcript 234801

• Transcript: Ll_transcript_130502
• CDS coordinates: 668-1213 (+)
• Peptide sequence: MPGIRPGVPPNYIMPYQFQRQGQPVQRVGARRAGNLQQVQQNQMLHHNSNQGFRYGRNGIDSVVPLPFDGSGVTEAPIDNQHPGELSNTLASALASATPENQRTMLGEHLYPLVGRLTPSSQTAKVTGMLLEMDKSEVIHLIESPDELKIKVSEALQVLREAGSGSDVGDQLGSLSLNNEI*
• ORF Type: complete

Annotations of Ll_transcript_130502

• Blastp: Polyadenylate-binding protein 5 from Arabidopsis with 46.03% of identity
• Blastx: Polyadenylate-binding protein 5 from Arabidopsis with 45.54% of identity
• Eggnog: poly(A) binding protein, cytoplasmic(ENOG410XR5X)
• Kegg: Link to kegg annotations (AT1G71770)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449781.1)
• Pfam: Poly-adenylate binding protein, unique domain (PF00658.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;