Protein coding transcript 23486

• Transcript: Ll_transcript_365026
• CDS coordinates: 35-358 (+)
• Peptide sequence: MFLNHAMFHDKSPPLLNSVFQVLGTPTREEVRCMNPNYNDFRFPQIKAHPWHKIFHKKMPPEAIDLASRLLQYSPSLRCSALEACAHPFFDELREPNARLPNGGPLPP
• ORF Type: 3prime_partial

Annotations of Ll_transcript_365026

• Blastp: Shaggy-related protein kinase iota from Arabidopsis with 77.06% of identity
• Blastx: Shaggy-related protein kinase iota from Arabidopsis with 77.06% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT1G06390)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419726.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;