Transcript | Ll_transcript_132165 |
---|---|
CDS coordinates | 237-671 (+) |
Peptide sequence | MDNSMYHRDVQLTRTYACPSHRDVHYSCGTCGYELNLSSSNRNTSSIGSKYSKFIKRGIMSFFNIDDSRFTQVDEIQCLPYFTRHSWGLFRRRTKLLCRKCGNHIGNSHNGFASSSGDSSPITNSSNETKYDIRIRALQPSYFE* |
ORF Type | complete |
Blastp | Uncharacterized protein At4g08330, chloroplastic from Arabidopsis with 63.2% of identity |
---|---|
Blastx | Uncharacterized protein At4g08330, chloroplastic from Arabidopsis with 63.2% of identity |
Eggnog | NA(ENOG41128JS) |
Kegg | Link to kegg annotations (AT4G08330) |
CantataDB | Link to cantataDB annotations (CNT0000812) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019430566.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer