Protein coding transcript 234870

• Transcript: Ll_transcript_132165
• CDS coordinates: 237-671 (+)
• Peptide sequence: MDNSMYHRDVQLTRTYACPSHRDVHYSCGTCGYELNLSSSNRNTSSIGSKYSKFIKRGIMSFFNIDDSRFTQVDEIQCLPYFTRHSWGLFRRRTKLLCRKCGNHIGNSHNGFASSSGDSSPITNSSNETKYDIRIRALQPSYFE*
• ORF Type: complete

Annotations of Ll_transcript_132165

• Blastp: Uncharacterized protein At4g08330, chloroplastic from Arabidopsis with 63.2% of identity
• Blastx: Uncharacterized protein At4g08330, chloroplastic from Arabidopsis with 63.2% of identity
• Eggnog: NA(ENOG41128JS)
• Kegg: Link to kegg annotations (AT4G08330)
• CantataDB: Link to cantataDB annotations (CNT0000812)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430566.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;