Protein coding transcript 23501

• Transcript: Ll_transcript_366488
• CDS coordinates: 804-1382 (+)
• Peptide sequence: MGDIYLNLQGILLKGGHVLDALASCYTIAFDKTGTLTTGGLVFKAIEPIYGHQIRNISNVSSCCIPTCEKEALAVASAMEKGTTHPIGRAVVDHSEGKDLPSVSIESFEYFPGRGLTATVNGIQSGTGGDKVLKATLGSVDFITSFCQSEDESKKIKEAVNTSSYGSDFVHAALSVNQKVVRLTTLIFLVDG*
• ORF Type: complete

Annotations of Ll_transcript_366488

• Blastp: Probable cadmium/zinc-transporting ATPase HMA1, chloroplastic from Arabidopsis with 74.32% of identity
• Blastx: Probable cadmium/zinc-transporting ATPase HMA1, chloroplastic from Arabidopsis with 78.54% of identity
• Eggnog: p-type ATPase(COG2217)
• Kegg: Link to kegg annotations (AT4G37270)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434685.1)
• Pfam: haloacid dehalogenase-like hydrolase (PF00702.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;