Protein coding transcript 235013

• Transcript: Ll_transcript_131918
• CDS coordinates: 664-1275 (+)
• Peptide sequence: MMSIYLSRSFPRSNSSLFLCSGKALQSEVLRLGEEMFLVDAGPGTAIICMQDELTGVPINRATRFEKKVGFLDLVAGESLIKKKILERLFIDLVAGESLIKERAAARFNDLVGSTDVVAGEPLLLLPRRFRQNRAWMELNKIWRTNTKVKGFIIKKVKGGYSVAIAGFITFIPFRCYKKRKRISNDRFTIESINPKRMNIVVF*
• ORF Type: complete

Annotations of Ll_transcript_131918

• Blastp: Ribosomal protein S1, mitochondrial from Marchantia with 35.12% of identity
• Blastx: NADH-ubiquinone oxidoreductase chain 5 from Triticum with 94.94% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431200.1)
• Pfam: -
• Rfam: Intron_gpII (RF00029)
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;