Protein coding transcript 235015

• Transcript: Ll_transcript_131923
• CDS coordinates: 53-430 (+)
• Peptide sequence: MLIVVTFISSLVHLYSISYMSEDPHSPRFMCYLSIFTFFMLMLVTGDNFLQLFLGWEGVGLASYLLIHFWFTRLQADKAAIKAMLVNRVGDFGLAPGISGRFTLFQTVDFSTIFARASAPRNSWIF
• ORF Type: 3prime_partial

Annotations of Ll_transcript_131923

• Blastp: NADH-ubiquinone oxidoreductase chain 5 from Triticum with 96.03% of identity
• Blastx: NADH-ubiquinone oxidoreductase chain 5 from Triticum with 96.15% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (YP_009237614.1)
• Pfam: NADH-Ubiquinone oxidoreductase (complex I), chain 5 N-terminus (PF00662.19)
• Rfam: Intron_gpII (RF00029)
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;