Protein coding transcript 23503

• Transcript: Ll_transcript_366490
• CDS coordinates: 651-1448 (+)
• Peptide sequence: MNKPKLERWLDEFGERYSKVVVVLSVAIAVIGPLVFKWPFISTPACRGSVYRALGLMVAASPCALAVAPLAYATAISSCARKGILLKGGHVLDALASCYTIAFDKTGTLTTGGLVFKAIEPIYGHQIRNISNVSSCCIPTCEKEALAVASAMEKGTTHPIGRAVVDHSEGKDLPSVSIESFEYFPGRGLTATVNGIQSGTGGDKVLKATLGSVDFITSFCQSEDESKKIKEAVNTSSYGSDFVHAALSVNQKVVRLTTLIFLVDG*
• ORF Type: complete

Annotations of Ll_transcript_366490

• Blastp: Probable cadmium/zinc-transporting ATPase HMA1, chloroplastic from Arabidopsis with 79.09% of identity
• Blastx: Probable cadmium/zinc-transporting ATPase HMA1, chloroplastic from Arabidopsis with 79.88% of identity
• Eggnog: p-type ATPase(COG2217)
• Kegg: Link to kegg annotations (AT4G37270)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434684.1)
• Pfam: E1-E2 ATPase (PF00122.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;