Protein coding transcript 235031

• Transcript: Ll_transcript_132573
• CDS coordinates: 62-1180 (+)
• Peptide sequence: MSNTKQFFARVRDSDKMKQIFAGISDPNKNKKKLLLSLFATLLLVASVIAIGVGVNSHKNSHHSHTIIKSACSSTFYPELCFSAISSEPGVTHKVSTHKDVIELSLNITTRAVEHNFFILEKLLTTEKGLSKREKTALHDCLEIIDETLDELKEARDDIRLYPNKKTLYQHADDLKTLISSAITNQFTCLDGFSHEDADKKVRTVLEKGLVHVEHLCSNSLAMTKNMTDNDIANYEQKMVVVGNKNRKLMEEEETGVKWPEWISTGDRRLLQATTVRADIVVAADGSGNFKTVSAAVAAAPEKSSKRFVIRIKAGVYRENVEVPKKKTNIMFLGDGRTNTIITGSRNVVDGSTTFHSATVGKFVNLVSFCTH*
• ORF Type: complete

Annotations of Ll_transcript_132573

• Blastp: Pectinesterase/pectinesterase inhibitor U1 from Lycopersicon with 62.64% of identity
• Blastx: Pectinesterase 3 from Citrus with 63.01% of identity
• Eggnog: pectinesterase(COG4677)
• Kegg: Link to kegg annotations (544016)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430276.1)
• Pfam: Plant invertase/pectin methylesterase inhibitor (PF04043.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;