Protein coding transcript 235039

• Transcript: Ll_transcript_132579
• CDS coordinates: 294-1076 (+)
• Peptide sequence: MFLGDSRTNTIITGTRNVIDGSTTFHSATVAIVGEQFLARDITFENTAGPSKHQAVALRVGADFSAFYNCDILAYQDTLYVHKNRQFFINCLIAGTVDFIFGNSAVVFQDCDIHARLPDSGQKNMVTAQGRVDPNQNTGIVIQKCRIGATQDLDPVKKNFPTYLGRPWKEYSRTVIMQTTISDVIEPVGWHEWNGNFALDTLVYREYQNTGPGAGTSNRVAWKGFKVITSDAEARAFTTESFIAGSTWLGSTGFPFSLEL*
• ORF Type: complete

Annotations of Ll_transcript_132579

• Blastp: Pectinesterase 3 from Citrus with 81.54% of identity
• Blastx: Pectinesterase 3 from Citrus with 78.82% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455536.1)
• Pfam: Pectinesterase (PF01095.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;