Protein coding transcript 235136

• Transcript: Ll_transcript_130646
• CDS coordinates: 3-308 (+)
• Peptide sequence: VEAALPIQHRQKQGIPIMSNGIFKSPMHRVVTNTEKLRMSVAMFNEPEPENEIGPVEGLIDEIRPRLYRNIKNYGDINYRSYQEGKIALEMVRIEDRNETI*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_130646

• Blastp: Probable 2-oxoglutarate/Fe(II)-dependent dioxygenase from Papaver with 39.51% of identity
• Blastx: Probable 2-oxoglutarate/Fe(II)-dependent dioxygenase from Papaver with 38.55% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452954.1)
• Pfam: 2OG-Fe(II) oxygenase superfamily (PF03171.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;