Protein coding transcript 235139

• Transcript: Ll_transcript_133335
• CDS coordinates: 1-408 (+)
• Peptide sequence: SHGPIHFRAPSKIFWRTVRGMIPHKTKRGEHALARLKVYEGIPPPFDKQKRLVVPDALKVLRLQKGHKYCLLGQLSSEVGWNYYDTIKELEKKRKERSQVVYERKKQLNKLRVKAEQVAQEKLGSQLDILAPVKY*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_133335

• Blastp: 60S ribosomal protein L13a from Lupinus with 98.52% of identity
• Blastx: 60S ribosomal protein L13a from Lupinus with 98.52% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448920.1)
• Pfam: Ribosomal protein L13 (PF00572.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;