Protein coding transcript 235140

• Transcript: Ll_transcript_133341
• CDS coordinates: 776-1123 (+)
• Peptide sequence: MIPHKTKRGEHALARLKVYEGIPPPFDKQKRLVVPDALKVLRLQKGHKYCLLGQLSSEVGWNYYDTIKELEKKRKERSQVVYERKKQLNKLRVKAEQVAQEKLGSQLDILAPVKY*
• ORF Type: complete

Annotations of Ll_transcript_133341

• Blastp: 60S ribosomal protein L13a from Lupinus with 100% of identity
• Blastx: 60S ribosomal protein L13a from Lupinus with 95.9% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448920.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;