Protein coding transcript 235156

• Transcript: Ll_transcript_130915
• CDS coordinates: 2405-2887 (+)
• Peptide sequence: MSSSSSSYYLYDVFLSFRGEDTRNNFTSSLYSALTDLNINTFMDKNLDKGTKVKPELYRAIEGSRISMVVFSPRYAGSRWCLDELVKIMECHRSNGQLVVPVFYNVDPAHVRHQIGDFGDSYTQLLRKQRWVNHANVLAEWKTALTDAANFVGWPVKSDK*
• ORF Type: complete

Annotations of Ll_transcript_130915

• Blastp: TMV resistance protein N from Nicotiana with 49.01% of identity
• Blastx: TMV resistance protein N from Nicotiana with 49.01% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425579.1)
• Pfam: TIR domain (PF01582.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;