Transcript | Ll_transcript_130924 |
---|---|
CDS coordinates | 3-710 (+) |
Peptide sequence | SSNSSNSPGFVDFQDVWCGPGIGFSTDAASVDYVVPKKNVSSRGKIDVEKITHRECSSYLGRRPVTPETISFLDTDPDIFAASDSFGPAAPIYRHIQDPSSDDSSDGFTEILLQGGLLMGGRLTRHDRFRRLRLDIDNMSYEQLLDLGERIGYVNAGLKEDEMGRNIRKTKFKFSHDASKNQVDRKCTICQEEYEADDELGKLNCKHSYHVRCIKQWVAQKNFCPVCKQQVMARH* |
ORF Type | 5prime_partial |
Blastp | E3 ubiquitin-protein ligase MBR1 from Arabidopsis with 48.31% of identity |
---|---|
Blastx | E3 ubiquitin-protein ligase MBR1 from Arabidopsis with 48.45% of identity |
Eggnog | zinc ion binding(ENOG41121N2) |
Kegg | Link to kegg annotations (AT2G15530) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019421951.1) |
Pfam | RING-H2 zinc finger domain (PF12678.6) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer