Transcript | Ll_transcript_130926 |
---|---|
CDS coordinates | 210-959 (+) |
Peptide sequence | MSSSSYHRYDVFLSFRGEDTRNTFTSSLYSALTQLTIKTFMDKNLAKGTKIKPELFRAIEGSRISIVVFSPRYAGSKWCLDELVKIMECHRSNAQIVVPVFYNVDPSHVRHQSGYFGDSYTQLIRKESLGNNPHVLAQWETALTEAANFVGWPVAPDNYNIIKLIVEDIYRRLDSTTLPITDFPVGLESRACDVIELLKGQSSAVRAIGIWGMGGSGKTTLAKVIFNQIHRDFEGTSFLANIREVWETNG |
ORF Type | 3prime_partial |
Blastp | TMV resistance protein N from Nicotiana with 44.49% of identity |
---|---|
Blastx | TMV resistance protein N from Nicotiana with 44.49% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | mtr-MIR2678 (MI0012053) |
Ncbi protein | Link to NCBI protein (XP_019425579.1) |
Pfam | TIR domain (PF01582.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer