Protein coding transcript 2352

• Transcript: Ll_transcript_329215
• CDS coordinates: 3-425 (+)
• Peptide sequence: FPDNPPDIVGGMSMSPSEIQAAATRFANSEAHLTHSVRPAKAESHVECSSEGTMLLHTESPSHCLSEGTVETVSDVTFNGMFPDLFAQTGSVNFAHEYGIYPGFDEFSGHYYVPEMETGNYYGEENMDGLIVDDSYLWNF*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_329215

• Blastp: Ethylene-responsive transcription factor ERF017 from Arabidopsis with 36.49% of identity
• Blastx: Ethylene-responsive transcription factor ERF017 from Arabidopsis with 36.49% of identity
• Eggnog: Transcription factor(ENOG410YNX4)
• Kegg: Link to kegg annotations (AT1G19210)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436258.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;