Protein coding transcript 235221

• Transcript: Ll_transcript_149899
• CDS coordinates: 884-1246 (+)
• Peptide sequence: MRAFRDNFKHLLGDTIVEIQVGMGPAGELRYPSYPEQNGTWKFPGIGAFQCYDKYMLSSLEAAAESQGKHEWGSTGPTDAGEYNNWPEDTIFFRKEGGGWDSKYGEIFPYLVLSDATRPW*
• ORF Type: complete

Annotations of Ll_transcript_149899

• Blastp: Beta-amylase 1, chloroplastic from Arabidopsis with 87.04% of identity
• Blastx: Beta-amylase 2, chloroplastic from Oryza sativa with 73.01% of identity
• Eggnog: beta-amylase(ENOG410XRH5)
• Kegg: Link to kegg annotations (AT3G23920)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431385.1)
• Pfam: Glycosyl hydrolase family 14 (PF01373.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;